HPA006915

MDC1 antibody from Sigma-Aldrich
Em:AB023051.5, KIAA0170, NFBD1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA006915
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA006915, RRID:AB_1853669
Product name
Anti-MDC1 protein antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA006915
Antibody type
Polyclonal
Antigen
MDC1 protein.
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
REAVLKDHTKIRALVRAHSEKDQPPFGDSDDSVEA
DKSSPGIHLERSQASTTVDINTQVEKEVPPGSAII
HIKKHQVSVEGTNQTDVKAVGGPAKLLVVSLEEAW
PLHGDCETDAEEGTSLTASVVADVRKSQLPAEGDA
G
Storage
-20C
Provider Type Product Number
- No reagents -