Antibody data
- Antibody Data
- Antigen structure
- References [4]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA042432 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA042432, RRID:AB_2677995
- Product name
- Anti-CXCR5
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
MNYPLTLEMDLENLEDLFWELDRLDNYNDTSLVEN
HLCPATEGPLMASFKAVF- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references T cell factor 1 (TCF-1) defines TÂ cell differentiation in colorectal cancer.
Differential expansion of T peripheral helper cells in early rheumatoid arthritis and osteoarthritis synovium.
Immune Cell Dynamics in Rhesus Macaques Infected with a Brazilian Strain of Zika Virus
Peritoneal carcinomatosis of colorectal cancer is characterized by structural and functional reorganization of the tumor microenvironment inducing senescence and proliferation arrest in cancer cells
Tran K, Kumari AN, Raghu D, Cox DRA, Goh SK, Perini MV, Muralidharan V, Tebbutt NC, Behren A, Mariadason J, Williams DS, Mielke LA
iScience 2024 Sep 20;27(9):110754
iScience 2024 Sep 20;27(9):110754
Differential expansion of T peripheral helper cells in early rheumatoid arthritis and osteoarthritis synovium.
Murray-Brown W, Guo Y, Small A, Lowe K, Weedon H, Smith MD, Lester SE, Proudman SM, Rao NL, Hao LY, Nagpal S, Wechalekar MD
RMD open 2022 Oct;8(2)
RMD open 2022 Oct;8(2)
Immune Cell Dynamics in Rhesus Macaques Infected with a Brazilian Strain of Zika Virus
Silveira E, Rogers K, Gumber S, Amancha P, Xiao P, Woollard S, Byrareddy S, Teixeira M, Villinger F
The Journal of Immunology 2017;199(3):1003-1011
The Journal of Immunology 2017;199(3):1003-1011
Peritoneal carcinomatosis of colorectal cancer is characterized by structural and functional reorganization of the tumor microenvironment inducing senescence and proliferation arrest in cancer cells
Seebauer C, Brunner S, Glockzin G, Piso P, Ruemmele P, Schlitt H, Geissler E, Fichtner-Feigl S, Kesselring R
OncoImmunology 2016;5(12):e1242543
OncoImmunology 2016;5(12):e1242543
No comments: Submit comment
No validations: Submit validation data