HPA010568

KIF11 antibody from Sigma-Aldrich
Eg5, HKSP, KNSL1, TRIP5
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA010568
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA010568, RRID:AB_1848034
Product name
Anti-KIF11 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA010568
Antibody type
Polyclonal
Antigen
Kinesin-like protein KIF11 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
ALIKEYTEEIERLKRDLAAAREKNGVYISEENFRV
MSGKLTVQEEQIVELIEKIGAVEEELNRVTELFMD
NKNELDQCKSDLQNKTQELETTQKHLQETKLQLVK
Storage
-20C
Provider Type Product Number
- No reagents -