HPA023447

DDX42 antibody from Atlas Antibodies
RHELP, RNAHP, SF3b125, SF3B8
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA023447
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA023447, RRID:AB_1847560
Product name
Anti-DDX42
Provider product page
Atlas Antibodies - HPA023447
Antibody type
Polyclonal
Reactivity
Human, Mouse, Rat
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
HGETGNRHSDSPRHGDGGRHGDGYRHPESSSRHTD
GHRHGENRHGGSAGRHGENRGANDGRNGESRKEAF
NRESKMEPKMEPKVDSSKMDKVDSKTDKTADGFAV
PEPPKRKKSR
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -