HPA023571

DDX42 antibody from Atlas Antibodies
RHELP, RNAHP, SF3b125, SF3B8
Validated within the Antibodypedia Validation Initative

Antibody data

Product number
HPA023571
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA023571, RRID:AB_1847561
Product name
Anti-DDX42
Provider product page
Atlas Antibodies - HPA023571
Antibody type
Polyclonal
Reactivity
Human, Mouse, Rat
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
FGATSSSSGFGKSAPPQLPSFYKIGSKRANFDEEN
AYFEDEEEDSSNVDLPYIPAENSPTRQQFHSKPVD
SDSDDDPLEAFMAEVEDQAARDMKRLEEKDKERKN
VKGIRDD
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -