Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN183339 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-DEAD (Asp-Glu-Ala-Asp) Box Polypeptide 42 (DDX42) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-DDX42 antibody: synthetic peptide directed towards the N terminal of human DDX42
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Chicken/Avian
- Host
- Rabbit
- Antigen sequence
PLEAFMAEVEDQAARDMKRLEEKDKERKNVKGIRD
DIEEE DDQEAYFRYM- Epitope
- N-Term
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
Characterization of novel SF3b and 17S U2 snRNP proteins, including a human Prp5p homologue and an SF3b DEAD-box protein.
Olsen JV, Blagoev B, Gnad F, Macek B, Kumar C, Mortensen P, Mann M
Cell 2006 Nov 3;127(3):635-48
Cell 2006 Nov 3;127(3):635-48
Characterization of novel SF3b and 17S U2 snRNP proteins, including a human Prp5p homologue and an SF3b DEAD-box protein.
Will CL, Urlaub H, Achsel T, Gentzel M, Wilm M, Lührmann R
The EMBO journal 2002 Sep 16;21(18):4978-88
The EMBO journal 2002 Sep 16;21(18):4978-88
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image
- Experimental details
- Image(s): Western Blotting