Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN404979 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-gamma-aminobutyric Acid (GABA) Receptor, rho 2 (GABRR2) (Middle Region) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-GABRR2 antibody: synthetic peptide directed towards the middle region of human GABRR2
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Chicken/Avian, Xenopus, Zebrafish
- Host
- Rabbit
- Antigen sequence
SNKSMTFDGRLVKKIWVPDVFFVHSKRSFTHDTTT
DNIML RVFPDGHVLY- Epitope
- Middle Region
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references mRNA and protein expression for novel GABAA receptors θ and ρ2 are altered in schizophrenia and mood disorders; relevance to FMRP-mGluR5 signaling pathway.
Multicentre search for genetic susceptibility loci in sporadic epilepsy syndrome and seizure types: a case-control study.
Fatemi SH, Folsom TD, Rooney RJ, Thuras PD
Translational psychiatry 2013 Jun 18;3:e271
Translational psychiatry 2013 Jun 18;3:e271
Multicentre search for genetic susceptibility loci in sporadic epilepsy syndrome and seizure types: a case-control study.
Cavalleri GL, Weale ME, Shianna KV, Singh R, Lynch JM, Grinton B, Szoeke C, Murphy K, Kinirons P, O'Rourke D, Ge D, Depondt C, Claeys KG, Pandolfo M, Gumbs C, Walley N, McNamara J, Mulley JC, Linney KN, Sheffield LJ, Radtke RA, Tate SK, Chissoe SL, Gibson RA, Hosford D, Stanton A, Graves TD, Hanna MG, Eriksson K, Kantanen AM, Kalviainen R, O'Brien TJ, Sander JW, Duncan JS, Scheffer IE, Berkovic SF, Wood NW, Doherty CP, Delanty N, Sisodiya SM, Goldstein DB
Lancet neurology 2007 Nov;6(11):970-80
Lancet neurology 2007 Nov;6(11):970-80
No comments: Submit comment
No validations: Submit validation data