HPA028244

DDX54 antibody from Sigma-Aldrich
APR-5, DP97, MGC2835
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA028244
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA028244, RRID:AB_10603885
Product name
Anti-DDX54 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA028244
Antibody type
Polyclonal
Antigen
DEAD (Asp-Glu-Ala-Asp) box polypeptide 54 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
VDTKLNEQLKTSFFLVREDTKAAVLLHLLHNVVRP
QDQTVVFVATKHHAEYLTELLTTQRVSCAHIYSAL
DPTARKINLAKFTLGKCSTLIVTDLAARGLDIPLL
DNVINYSFP
Storage
-20C
Provider Type Product Number
- No reagents -