H00023126-B01

POGZ antibody from Abnova Corporation
KIAA0461, ZNF280E, ZNF635m

Antibody data

Product number
H00023126-B01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00023126-B01, RRID:AB_1138808
Product name
POGZ MaxPab mouse polyclonal antibody (B01)
Provider product page
Abnova Corporation - H00023126-B01
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length human POGZ protein.
Antigen sequence
MADTDLFMECEEEELEPWQKISDVIEDSVVEDYNS
VDKTTTAGNPLVQQGGQPLILTQNPAPGLGTMVTQ
PVLRPVQVMQNANHVTSSPVASQPIFITTQGFPVR
NVRPVQNAMNQVGIVLNVQQGQTVRPITLVPAPGT
QFVKPTVGVPQVFSQMTPVRPGSTMPVRPTTNTFT
TVIPATLTIRSTVPQSQSQQTKSTPSTSTTPTATQ
PTSLGQLAVQSPGQSNQTTNPKLAPSFPSPPAVSI
ASFVTVKRPGVTGENSNEVAKLVNTLNTIPSLGQS
PGPVVVSNNSSAHGSQRTSGPESSMKVTSSIPVFD
LQDGGRKICPRCNAQFRVTEALRGHMCYCCPEMVE
YQKKGKSLDSEPSVPSAAKPPSPEKTAPVASTPSS
TPIPALSPPTKVPEPNENVGDAVQTKLIMLVDDFY
YGRDGGKVAQLTNFPKVATSFRCPHCTKRLKNNIR
FMNHMKHHVELDQQNGEVDGHTICQHCYRQFSTPF
QLQCHLENVHSPYESTTKCKICEWAFESEPLFLQH
MKDTHKPGEMPYVCQVCQYRSSLYSEVDVHFRMIH
EDTRHLLCPYCLKVFKNGNAFQQHYMRHQKRNVYH
CNKCRLQFLFAKDKIEHKLQHHKTFRKPKQLEGLK
PGTKVTIRASRGQPRTVPVSSNDTPPSALQEAAPL
TSSMDPLPVFLYPPVQRSIQKRAVRKMSVMGRQTC
LECSFEIPDFPNHFPTYVHCSLCRYSTCCSRAYAN
HMINNHVPRKSPKYLALFKNSVSGIKLACTSCTFV
TSVGDAMAKHLVFNPSHRSSSILPRGLTWIAHSRH
GQTRDRVHDRNVKNMYPPPSFPTNKAATVKSAGAT
PAEPEELLTPLAPALPSPASTATPPPTPTHPQALA
LPPLATEGAECLNVDDQDEGSPVTQEPELASGGGG
SGGVGKKEQLSVKKLRVVLFALCCNTEQAAEHFRN
PQRRIRRWLRRFQASQGENLEGKYLSFEAEEKLAE
WVLTQREQQLPVNEETLFQKATKIGRSLEGGFKIS
YEWAVRFMLRHHLTPHARRAVAHTLPKDVAENAGL
FIDFVQRQIHNQDLPLSMIVAIDEISLFLDTEVLS
SDDRKENALQTVGTGEPWCDVVLAILADGTVLPTL
VFYRGQMDQPANMPDSILLEAKESGYSDDEIMELW
STRVWQKHTACQRSKGMLVMDCHRTHLSEEVLAML
SASSTLPAVVPAGCSSKIQPLDVCIKRTVKNFLHK
KWKEQAREMADTACDSDVLLQLVLVWLGEVLGVIG
DCPELVQRSFLVASVLPGPDGNINSPTRNADMQEE
LIASLEEQLKLSGEHSESSTPRPRSSPEETIEPES
LHQLFEGESETESFYGFEEADLDLMEI
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -