HPA006800

POGZ antibody from Sigma-Aldrich
KIAA0461, ZNF280E, ZNF635m
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA006800
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA006800, RRID:AB_1855516
Product name
Anti-POGZ antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA006800
Antibody type
Polyclonal
Antigen
Pogo transposable element with ZNF domain recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
GEPWCDVVLAILADGTVLPTLVFYRGQMDQPANMP
DSILLEAKESGYSDDEIMELWSTRVWQKHTACQRS
KGMLVMDCHRTHLSEEVLAMLSASSTLPAVVPAGC
SSKIQPLDVCIKRTVKNFLH
Storage
-20C
Provider Type Product Number
- No reagents -