HPA062430

antibody from Atlas Antibodies

Targeting: PNLIP PL

Antibody data

Submit

Validation data

Product number: HPA062430 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA062430, RRID:AB_2684761
Product name: Anti-PNLIP
Antibody type: Polyclonal
Reactivity: Human
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: PTLPRVGASKIIVETNVGKQFNFCSPETVR
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

PNLIP protein structure - HPA062430 shown in red.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Orthogonal validation
Main image
Experimental details: Immunohistochemistry analysis in human pancreas and tonsil tissues using Anti-PNLIP antibody. Corresponding PNLIP RNA-seq data are presented for the same tissues.
Sample type: HUMAN
Orthogonal method: Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Independent antibody validation
Main image
Experimental details: Immunohistochemical staining of human colon, kidney, liver and pancreas using Anti-PNLIP antibody HPA062430 (A) shows similar protein distribution across tissues to independent antibody HPA062494 (B).
Antibody #2 product nr: HPA062494
Antibody provider: Atlas Antibodies

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human pancreas shows strong cytoplasmic positivity in exocrine glandular cells.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human pancreas shows high expression.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human tonsil shows low expression as expected.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human kidney using Anti-PNLIP antibody HPA062430.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human colon using Anti-PNLIP antibody HPA062430.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human liver using Anti-PNLIP antibody HPA062430.
Sample type: HUMAN