Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN182894 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Pancreatic Lipase (PNLIP) (C-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-PNLIP antibody: synthetic peptide directed towards the C terminal of human PNLIP
- Description
- Protein A purified
- Reactivity
- Human
- Host
- Rabbit
- Antigen sequence
GHYADRYPGKTNDVGQKFYLDTGDASNFARWRYKV
SVTLS GKKVTGHILV- Epitope
- C-Term
- Vial size
- 100 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Partial loss of pancreas endocrine and exocrine cells of human ARX-null mutation: consideration of pancreas differentiation.
Time-resolved fluorescence allows selective monitoring of Trp30 environmental changes in the seven-Trp-containing human pancreatic lipase.
Itoh M, Takizawa Y, Hanai S, Okazaki S, Miyata R, Inoue T, Akashi T, Hayashi M, Goto Y
Differentiation; research in biological diversity 2010 Sep-Oct;80(2-3):118-22
Differentiation; research in biological diversity 2010 Sep-Oct;80(2-3):118-22
Time-resolved fluorescence allows selective monitoring of Trp30 environmental changes in the seven-Trp-containing human pancreatic lipase.
Ramos P, Coste T, Piémont E, Lessinger JM, Bousquet JA, Chapus C, Kerfelec B, Férard G, Mély Y
Biochemistry 2003 Nov 4;42(43):12488-96
Biochemistry 2003 Nov 4;42(43):12488-96
No comments: Submit comment
No validations: Submit validation data