HPA021648

PMPCA antibody from Atlas Antibodies
Alpha-MPP, CLA1, INPP5E, KIAA0123, SCAR2
Validated within the Antibodypedia Validation Initative

Antibody data

Product number
HPA021648
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA021648, RRID:AB_1855491
Product name
Anti-PMPCA
Provider product page
Atlas Antibodies - HPA021648
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
VEHEHLVDCARKYLLGVQPAWGSAEAVDIDRSVAQ
YTGGIAKLERDMSNVSLGPTPIPELTHIMVGLESC
SFLEEDFIPFAVLNMMMGGGGSFSAGGPGKGMFSR
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -