HPA021648

Alpha-MPP, CLA1, INPP5E, KIAA0123, SCAR2

Antibody data

Submit

Validation data

Product number: HPA021648
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA021648, RRID:AB_1855491
Product name: Anti-PMPCA
Provider product page: Atlas Antibodies - HPA021648
Antibody type: Polyclonal
Reactivity: Human
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: VEHEHLVDCARKYLLGVQPAWGSAEAVDIDRSVAQ YTGGIAKLERDMSNVSLGPTPIPELTHIMVGLESC SFLEEDFIPFAVLNMMMGGGGSFSAGGPGKGMFSR
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Supportive validation

Enhanced validation

Submitted by: klas2
Enhanced method: Genetic validation
Main image
Experimental details: Western blot of cell lysate from U-2 OS cells transfected with either siRNA targeting PMPCA or control siRNA. Lane 1: Marker (250, 130, 95, 72, 55, 36, 28, 17, 10) Lane 2: Cell lysate from U-2OS cells transfected with siRNA targeting PMPCA Lane 3: N/A Lane 4: Cell lysate from U-2OS cells transfected with control siRNA Right image, lane 1-4: loading control
Sample type: U-2 OS
Primary Ab dilution: 1:508
Conjugate: Horseradish Peroxidase
Secondary Ab: Secondary Ab
Secondary Ab dilution: 1:3000
Knockdown/Genetic Approaches Application: Western blot
KD Reagent Type: siRNA
Downregulation: >75%
KD Reagent Provider: Thermo Fisher Scientific
KD Reagent Prod no: s223577
KD Reagent Prod page: KD Reagent Prod page
KD Reagent Page 2: KD Reagent Page 2
KD Reagent Prod no 2: s332
KD Reagent Prod no 3: s333
KD Reagent Page 3: KD Reagent Page 3
Antibody Lot Number: R11095
Appendix: 566d8d6e0d99d.pdf

Supportive validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Genetic validation
Main image
Experimental details: Western blot analysis in HEK293 cells transfected with control siRNA, target specific siRNA probe #1, using Anti-PMPCA antibody. Remaining relative intensity is presented. Loading control: Anti-PPIB.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Independent antibody validation
Main image
Experimental details: Western blot analysis using Anti-PMPCA antibody HPA021648 (A) shows similar pattern to independent antibody HPA063735 (B).
Sample type: HUMAN
Antibody #2 product nr: HPA063735
Antibody provider: Atlas Antibodies