HPA021648

PMPCA antibody from Sigma-Aldrich
Alpha-MPP, INPP5E, KIAA0123
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA021648
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA021648, RRID:AB_1855491
Product name
Anti-PMPCA antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA021648
Antibody type
Polyclonal
Antigen
Mitochondrial-processing peptidase subunit alpha Precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
VEHEHLVDCARKYLLGVQPAWGSAEAVDIDRSVAQ
YTGGIAKLERDMSNVSLGPTPIPELTHIMVGLESC
SFLEEDFIPFAVLNMMMGGGGSFSAGGPGKGMFSR
Storage
-20C
Provider Type Product Number
- No reagents -