HPA021815

ABCF2 antibody from Atlas Antibodies
ABC28, EST133090, HUSSY-18, M-ABC1
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA021815
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA021815, RRID:AB_1844440
Product name
Anti-ABCF2
Provider product page
Atlas Antibodies - HPA021815
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
NHLDIETIDALADAINEFEGGMMLVSHDFRLIQQV
AQEIWVCEKQTITKWPGDILAYKEHLKSKLVDEEP
QLTKRTHNVCTLTLASLPRP
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -