H00010061-M01

ABCF2 antibody from Abnova Corporation
ABC28, EST133090, HUSSY-18, M-ABC1

Antibody data

Product number
H00010061-M01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00010061-M01, RRID:AB_425827
Product name
ABCF2 monoclonal antibody (M01), clone 1D11
Provider product page
Abnova Corporation - H00010061-M01
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant ABCF2.
Antigen sequence
MPSDLAKKKAAKKKEAAKARQRPRKGHEENGDVVT
EPQVAEKNEANGRETTEVDLLTKELEDFEMKKAAA
RAVTGVLASHPNSTDVHIINLSLTFHGQELLSDTK
LELNS
Isotype
IgG
Antibody clone number
1D11
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -