H00010061-B01

ABCF2 antibody from Abnova Corporation
ABC28, EST133090, HUSSY-18, M-ABC1

Antibody data

Product number
H00010061-B01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00010061-B01, RRID:AB_982294
Product name
ABCF2 MaxPab mouse polyclonal antibody (B01)
Provider product page
Abnova Corporation - H00010061-B01
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length human ABCF2 protein.
Antigen sequence
MPSDLAKKKAAKKKEAAKARQRPRKGHEENGDVVT
EPQVAEKNEANGRETTEVDLLTKELEDFEMKKAAA
RAVTGVLASHPNSTDVHIINLSLTFHGQELLSDTK
LELNSGRRYGLIGLNGIGKSMLLSAIGKREVPIPE
HIDIYHLTREMPPSDKTPLHCVMEVDTERAMLEKE
AERLAHEDAECEKLMELYERLEELDADKAEMRASR
ILHGLGFTPAMQRKKLKDFSGGWRMRVALARALFI
RPFMLLLDEPTNHLDLDACVWLEEELKTFKRILVL
VSHSQDFLNGVCTNIIHMHNKKLKYYTGNYDQYVK
TRLELEENQMKRFHWEQDQIAHMKNYIARFGHGSA
KLARQAQSKEKTLQKMMASGLTERVVSDKTLSFYF
PPCGKIPPPVIMVQNVSFKYTKDGPCIYNNLEFGI
DLDTRVALVGPNGAGKSTLLKLLTGELLPTDGMIR
KHSHVKIGRYHQHLQEQLDLDLSPLEYMMKCYPEI
KEKEEMRKIIGRYGLTGKQQVSPIRNLSDGQKCRV
CLAWLAWQNPHMLFLDEPTNHLDIETIDALADAIN
EFEGGMMLVSHDFRLIQQVAQEIWVCEKQTITKWP
GDILAYKEHLKSKLVDEEPQLTKRTHNV
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -