Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN311328 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Prostate Tumor Overexpressed 1 (PTOV1) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-PTOV1 antibody: synthetic peptide directed towards the N terminal of human PTOV1
- Reactivity
- Human, Mouse, Rat, Bovine
- Host
- Rabbit
- Antigen sequence
DSTAKLKRTLPCQAYVNQGENLETDQWPQKLIMQL
IPQQL LTTLGPLFRN- Vial size
- 50 µg
Submitted references PTOV1 antagonizes MED25 in RAR transcriptional activation.
PTOV1 enables the nuclear translocation and mitogenic activity of flotillin-1, a major protein of lipid rafts.
Youn HS, Park UH, Kim EJ, Um SJ
Biochemical and biophysical research communications 2011 Jan 7;404(1):239-44
Biochemical and biophysical research communications 2011 Jan 7;404(1):239-44
PTOV1 enables the nuclear translocation and mitogenic activity of flotillin-1, a major protein of lipid rafts.
Santamaría A, Castellanos E, Gómez V, Benedit P, Renau-Piqueras J, Morote J, Reventós J, Thomson TM, Paciucci R
Molecular and cellular biology 2005 Mar;25(5):1900-11
Molecular and cellular biology 2005 Mar;25(5):1900-11
No comments: Submit comment
No validations: Submit validation data