Explore
Validate
Learn
Western blotAntibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [2]
- ELISA [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00001615-M01 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00001615-M01, RRID:AB_489852
- Product name
- DARS monoclonal antibody (M01), clone 2F11
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant DARS.
- Antigen sequence
KYPLAVRPFYTMPDPRNPKQSNSYDMFMRGEEILS
GAQRIHDPQLLTERALHHGIDLEKIKAYIDSFRFG
APPHAGGGIGLERVTMLFLGLHNVRQTSMFPRDPK
RLT- Isotype
- IgG
- Antibody clone number
- 2F11
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Proteomic identification of putative biomarkers of radiotherapy resistance: a possible role for the 26S proteasome?
Smith L, Qutob O, Watson MB, Beavis AW, Potts D, Welham KJ, Garimella V, Lind MJ, Drew PJ, Cawkwell L
Neoplasia (New York, N.Y.) 2009 Nov;11(11):1194-207
Neoplasia (New York, N.Y.) 2009 Nov;11(11):1194-207
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- DARS monoclonal antibody (M01), clone 2F11 Western Blot analysis of DARS expression in HeLa ( Cat # L013V1 ).
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western Blot analysis of DARS expression in transfected 293T cell line by DARS monoclonal antibody (M01), clone 2F11.Lane 1: DARS transfected lysate(57.1 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged DARS is approximately 0.3ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunoperoxidase of monoclonal antibody to DARS on formalin-fixed paraffin-embedded human colon. [antibody concentration 3 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol
