HPA020451

DARS1 antibody from Sigma-Aldrich
DARS
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA020451
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA020451, RRID:AB_1847479
Product name
Anti-DARS antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA020451
Antibody type
Polyclonal
Antigen
Aspartyl-tRNA synthetase, cytoplasmic recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LHVQKIYVISLAEPRLPLQLDDAVRPEAEGEEEGR
ATVNQDTRLDNRVIDLRTSTSQAVFRLQSGICHLF
RETLINKGFVEIQTPKIISAASEGGANVFTVSYFK
NNAYLAQSPQLYKQMCICAD
Storage
-20C
Provider Type Product Number
- No reagents -