HPA006694

PAXIP1 antibody from Sigma-Aldrich
CAGF28, CAGF29, PAXIP1L, PTIP, TNRC2
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA006694
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA006694, RRID:AB_1855011
Product name
Anti-PAXIP1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA006694
Antibody type
Polyclonal
Antigen
PAX-interacting protein 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
EEEEEVENEEQDSQNEGSTDEKSSPASSQEGSPSG
DQQFSPKSNTEKSKGELMFDDSSDSSPEKQERNLN
WTPAEVPQLAAAKRRLPQGKEPGLINLCANVPPVP
GNILPPEVRGNLMAAGQNLQSSERS
Storage
-20C
Provider Type Product Number
- No reagents -