HPA020992

CHPF2 antibody from Sigma-Aldrich
ChSy-3, CSGlcA-T, KIAA1402
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA020992
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA020992, RRID:AB_1847267
Product name
Anti-AC021097.5 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA020992
Antibody type
Polyclonal
Antigen
Chondroitin sulfate glucuronyltransferase recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
PCVEAVGERGGPQNPDSRARLDQSDEDFKPRIVPY
YRDPNKPYKKVLRTRYIQTELGSRERLLVAVLTSR
ATLST
Storage
-20C
Provider Type Product Number
- No reagents -