Antibody data
- Antibody Data
- Antigen structure
- References [3]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
- Immunocytochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00006604-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00006604-M01, RRID:AB_607058
- Product name
- SMARCD3 monoclonal antibody (M01), clone 1G6
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant SMARCD3.
- Antigen sequence
ISALDSKIHETIESINQLKIQRDFMLSFSRDPKGY
VQDLLRSQSRDLKVMTDVAGNPEEERRAEFYHQPW
SQEAVSRYFYCKIQQRRQELEQSLVVRNT- Isotype
- IgG
- Antibody clone number
- 1G6
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Directing cardiomyogenic differentiation of human pluripotent stem cells by plasmid-based transient overexpression of cardiac transcription factors.
Massively parallel sequencing identifies the gene Megf8 with ENU-induced mutation causing heterotaxy.
The core component of the mammalian SWI/SNF complex SMARCD3/BAF60c is a coactivator for the nuclear retinoic acid receptor.
Hartung S, Schwanke K, Haase A, David R, Franz WM, Martin U, Zweigerdt R
Stem cells and development 2013 Apr 1;22(7):1112-25
Stem cells and development 2013 Apr 1;22(7):1112-25
Massively parallel sequencing identifies the gene Megf8 with ENU-induced mutation causing heterotaxy.
Zhang Z, Alpert D, Francis R, Chatterjee B, Yu Q, Tansey T, Sabol SL, Cui C, Bai Y, Koriabine M, Yoshinaga Y, Cheng JF, Chen F, Martin J, Schackwitz W, Gunn TM, Kramer KL, De Jong PJ, Pennacchio LA, Lo CW
Proceedings of the National Academy of Sciences of the United States of America 2009 Mar 3;106(9):3219-24
Proceedings of the National Academy of Sciences of the United States of America 2009 Mar 3;106(9):3219-24
The core component of the mammalian SWI/SNF complex SMARCD3/BAF60c is a coactivator for the nuclear retinoic acid receptor.
Flajollet S, Lefebvre B, Cudejko C, Staels B, Lefebvre P
Molecular and cellular endocrinology 2007 May 30;270(1-2):23-32
Molecular and cellular endocrinology 2007 May 30;270(1-2):23-32
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- SMARCD3 monoclonal antibody (M01), clone 1G6 Western Blot analysis of SMARCD3 expression in K-562 ( Cat # L009V1 ).
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged SMARCD3 is approximately 0.3ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunofluorescence of monoclonal antibody to SMARCD3 on HeLa cell. [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol