H00006604-M01A

SMARCD3 antibody from Abnova Corporation
BAF60C, CRACD3, Rsc6p

Antibody data

Product number
H00006604-M01A
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00006604-M01A, RRID:AB_1580783
Product name
SMARCD3 monoclonal antibody (M01A), clone 1G6
Provider product page
Abnova Corporation - H00006604-M01A
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant SMARCD3.
Antigen sequence
ISALDSKIHETIESINQLKIQRDFMLSFSRDPKGY
VQDLLRSQSRDLKVMTDVAGNPEEERRAEFYHQPW
SQEAVSRYFYCKIQQRRQELEQSLVVRNT
Isotype
IgG
Antibody clone number
1G6
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -