Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN183201 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-SWI/SNF Related, Matrix Associated, Actin Dependent Regulator of Chromatin, Subfamily D, Member 3 (SMARCD3) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-SMARCD3 antibody: synthetic peptide directed towards the N terminal of human SMARCD3
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Xenopus, Zebrafish
- Host
- Rabbit
- Antigen sequence
KRVDIQEALKRPMKQKRKLRLYISNTFNPAKPDAE
DSDGS IASWELRVEG- Vial size
- 50 μg
- Storage
- Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen. For longer periods of storage, store at -20°C
Submitted references Transcription factors and nuclear receptors interact with the SWI/SNF complex through the BAF60c subunit.
Debril MB, Gelman L, Fayard E, Annicotte JS, Rocchi S, Auwerx J
The Journal of biological chemistry 2004 Apr 16;279(16):16677-86
The Journal of biological chemistry 2004 Apr 16;279(16):16677-86
No comments: Submit comment
No validations: Submit validation data