HPA006735

FAM208A antibody from Atlas Antibodies
C3orf63, KIAA1105, RAP140, se89-1
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA006735
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA006735, RRID:AB_1234635
Product name
Anti-FAM208A
Provider product page
Atlas Antibodies - HPA006735
Antibody type
Polyclonal
Description
Affinity purified using the PrEST antigen as affinity ligand
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
TIIIKASAKGGNLPPVSPNDSGAKIASNPLERHVI
PVSSSDFNNKHLLEPLCSDPLKDTNSDEQHSTSAL
TEVEMNQPQHATELMVTSDHIVPGDMAREPVEETT
KSPSDVNISAQPALSN
Isotype
IgG
Vial size
100 µl
Storage
Store at +4¡C for short term storage. Long time storage is recommended at -20¡C.
Provider Type Product Number
- No reagents -