HPA006735

TASOR antibody from Atlas Antibodies
C3orf63, FAM208A, KIAA1105, RAP140, se89-1, TASOR1
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA006735
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA006735, RRID:AB_1852384
Product name
Anti-FAM208A
Provider product page
Atlas Antibodies - HPA006735
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
TIIIKASAKGGNLPPVSPNDSGAKIASNPLERHVI
PVSSSDFNNKHLLEPLCSDPLKDTNSDEQHSTSAL
TEVEMNQPQHATELMVTSDHIVPGDMAREPVEETT
KSPSDVNISAQPALSN
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -