HPA017142

FAM208A antibody from Sigma-Aldrich
C3orf63, KIAA1105, RAP140, se89-1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA017142
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA017142, RRID:AB_1852382
Product name
Anti-C3orf63 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA017142
Antibody type
Polyclonal
Antigen
retinoblastoma-associated protein 140 isoform b recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
GKWQWKVHCKFQKKLKELGRLNAKALSLLTLLNVY
QKKHLVEILSYHNCDSQTRNAPELDCLIRLQAQNI
QQRHIVFLTEKNIKMLSSYTDNGIVVATAEDFMQN
FKNLVGYHNSITEENLPQLGANENLES
Storage
-20C
Provider Type Product Number
- No reagents -