HPA017142

TASOR antibody from MilliporeSigma / Merck KGaA
C3orf63, FAM208A, KIAA1105, RAP140, se89-1, TASOR1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA017142
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA017142, RRID:AB_1852382
Product name
Anti-C3orf63 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA017142
Antibody type
Polyclonal
Antigen
retinoblastoma-associated protein 140 isoform b recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
GKWQWKVHCKFQKKLKELGRLNAKALSLLTLLNVY
QKKHLVEILSYHNCDSQTRNAPELDCLIRLQAQNI
QQRHIVFLTEKNIKMLSSYTDNGIVVATAEDFMQN
FKNLVGYHNSITEENLPQLGANENLES
Storage
-20C
Provider Type Product Number
- No reagents -