PAB28235

TASOR antibody from Abnova Corporation
C3orf63, FAM208A, KIAA1105, RAP140, se89-1, TASOR1

Antibody data

Product number
PAB28235
Provider
Abnova Corporation
Product name
C3orf63 polyclonal antibody
Provider product page
Abnova Corporation - PAB28235
Antibody type
Polyclonal
Description
Rabbit polyclonal antibody raised against recombinant C3orf63.
Antigen sequence
GKWQWKVHCKFQKKLKELGRLNAKALSLLTLLNVY
QKKHLVEILSYHNCDSQTRNAPELDCLIRLQAQNI
QQRHIVFLTEKNIKMLSSYTDNGIVVATAEDFMQN
FKNLVGYHNSITEENLPQLGANENLES
Isotype
IgG
Storage
Store at 4°C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -