HPA017142
antibody from Atlas Antibodies
Targeting: TASOR
C3orf63, FAM208A, KIAA1105, RAP140, se89-1, TASOR1
Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA017142 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA017142, RRID:AB_1852382
- Product name
- Anti-FAM208A
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
GKWQWKVHCKFQKKLKELGRLNAKALSLLTLLNVY
QKKHLVEILSYHNCDSQTRNAPELDCLIRLQAQNI
QQRHIVFLTEKNIKMLSSYTDNGIVVATAEDFMQN
FKNLVGYHNSITEENLPQLGANENLES- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references The HUSH complex is a gatekeeper of type I interferon through epigenetic regulation of LINE-1s.
The first mouse mutants of D14Abb1e (Fam208a) show that it is critical for early development
Tunbak H, Enriquez-Gasca R, Tie CHC, Gould PA, Mlcochova P, Gupta RK, Fernandes L, Holt J, van der Veen AG, Giampazolias E, Burns KH, Maillard PV, Rowe HM
Nature communications 2020 Nov 3;11(1):5387
Nature communications 2020 Nov 3;11(1):5387
The first mouse mutants of D14Abb1e (Fam208a) show that it is critical for early development
Harten S, Bruxner T, Bharti V, Blewitt M, Nguyen T, Whitelaw E, Epp T
Mammalian Genome 2014;25(7-8):293-303
Mammalian Genome 2014;25(7-8):293-303
No comments: Submit comment
No validations: Submit validation data