HPA021086

WDR86 antibody from Sigma-Aldrich
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA021086
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA021086, RRID:AB_2241631
Product name
Anti-WDR86 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA021086
Antibody type
Polyclonal
Antigen
WD repeat domain 86 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
MSREFRGHRNCVLTLAYSAPWDLPSTPCAEEAAAG
GLLVTGSTDGTAKVWQVASGCCHQTLRGHTGAVLC
LVLDTPGHTAFTGSTDATIRAWDILSG
Storage
-20C
Provider Type Product Number
- No reagents -