HPA009674

ALKBH3 antibody from Sigma-Aldrich
DEPC-1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA009674
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA009674, RRID:AB_1850460
Product name
Anti-ALKBH3 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA009674
Antibody type
Polyclonal
Antigen
Alpha-ketoglutarate-dependent dioxygenase alkB homolog 3 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
WAAPVKSQAIAQPATTAKSHLHQKPGQTWKNKEHH
LSDREFVFKEPQQVVRRAPEPRVIDREGVYEISLS
PTGVSRVCLYPGFVDVKEADWILEQLCQDVPWKQR
TGIREDITYQQPRLTAWYGEL
Storage
-20C
Provider Type Product Number
- No reagents -