H00064393-B01P

ZMAT3 antibody from Abnova Corporation
FLJ12296, MGC10613, PAG608, WIG-1, WIG1

Antibody data

Product number
H00064393-B01P
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00064393-B01P, RRID:AB_1139115
Product name
WIG1 purified MaxPab mouse polyclonal antibody (B01P)
Provider product page
Abnova Corporation - H00064393-B01P
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length human WIG1 protein.
Antigen sequence
MILLQHAVLPPPKQPSPSPPMSVATRSTGTLQLPP
QKPFGQEASLPLAGEEELSKGGEQDCALEELCKPL
YCKLCNVTLNSAQQAQAHYQGKNHGKKLRNYYAAN
SCPPPARMSNVVEPAATPVVPVPPQMGSFKPGGRV
ILATENDYCKLCDASFSSPAVAQAHYQGKNHAKRL
RLAEAQSNSFSESSELGQRRARKEGNEFKMMPNRR
NMYTVQNNSAGPYFNPRSRQRIPRDLAMCVTPSGQ
FYCSMCNVGAGEEMEFRQHLESKQHKSKVSEQRYR
NEMENLGYV
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -