HPA019544

AGPAT2 antibody from Sigma-Aldrich
BSCL, LPAAT-beta
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA019544
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA019544, RRID:AB_1844646
Product name
Anti-AGPAT2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA019544
Antibody type
Polyclonal
Antigen
1-acyl-sn-glycerol-3-phosphate acyltransferase beta recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
YNTKKKFFTSGTVTVQVLEAIPTSGLTAADVPALV
DTCHRAMRTTFLHISKTPQENGATAGSG
Storage
-20C
Provider Type Product Number
- No reagents -