Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00002018-M06 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00002018-M06, RRID:AB_581838
- Product name
- EMX2 monoclonal antibody (M06), clone 4F7
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant EMX2.
- Antigen sequence
HSPHPLFASQQRDPSTFYPWLIHRYRYLGHRFQGN
DTSPESFLLHNALARKPKRIRTAFSPSQLLRLEHA
FEKNHYVVGAERKQLAHSLSLTETQVKV- Isotype
- IgG
- Antibody clone number
- 4F7
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Emx2 expression levels in NSCs modulate astrogenesis rates by regulating EgfR and Fgf9.
Falcone C, Filippis C, Granzotto M, Mallamaci A
Glia 2015 Mar;63(3):412-22
Glia 2015 Mar;63(3):412-22
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunoperoxidase of monoclonal antibody to EMX2 on formalin-fixed paraffin-embedded human cerebral cortex. [antibody concentration 3 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol