Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00006009-M01 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00006009-M01, RRID:AB_1112097
- Product name
- RHEB monoclonal antibody (M01), clone 2C11
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a full-length recombinant RHEB.
- Antigen sequence
MPQSKSRKIAILGYRSVGKSSLTIQFVEGQFVDSY
DPTIENTFTKLITVNGQEYHLQLVDTAGQDEYSIF
PQTYSIDINGYILVYSVTSIKSFEVIKVIHGKLLD
MVGKVQIPIMLVGNKKDLHMERVISYEEGKALAES
WNAAFLESSAKENQTAVDVFRRIILEAEKMDGAAS
QGKSSCSVM- Isotype
- IgG
- Antibody clone number
- 2C11
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references p53 Deletion or Hotspot Mutations Enhance mTORC1 Activity by Altering Lysosomal Dynamics of TSC2 and Rheb.
Spatial control of the TSC complex integrates insulin and nutrient regulation of mTORC1 at the lysosome.
Agarwal S, Bell CM, Taylor SM, Moran RG
Molecular cancer research : MCR 2016 Jan;14(1):66-77
Molecular cancer research : MCR 2016 Jan;14(1):66-77
Spatial control of the TSC complex integrates insulin and nutrient regulation of mTORC1 at the lysosome.
Menon S, Dibble CC, Talbott G, Hoxhaj G, Valvezan AJ, Takahashi H, Cantley LC, Manning BD
Cell 2014 Feb 13;156(4):771-85
Cell 2014 Feb 13;156(4):771-85
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- RHEB monoclonal antibody (M01), clone 2C11. Western Blot analysis of RHEB expression in Raw 264.7 ( Cat # L024V1 ).
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged RHEB is approximately 3ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol