HPA006719

TERF2IP antibody from Sigma-Aldrich
RAP1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA006719
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA006719, RRID:AB_1858267
Product name
Anti-TERF2IP antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA006719
Antibody type
Polyclonal
Antigen
Telomeric repeat-binding factor 2-interacting protein 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
REFEEVVVDESPPDFEIHITMCDDDPPTPEEDSET
QPDEEEEEEEEKVSQPEVGAAIKIIRQLMEKFNLD
LSTVTQAFLKNSGELEATSAFLASGQRADGYPIWS
RQDDIDLQKDDEDTREALVKKFGAQNVAR
Storage
-20C
Provider Type Product Number
- No reagents -