HPA006721

POLH antibody from Atlas Antibodies
RAD30A, XP-V
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA006721
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA006721, RRID:AB_1847785
Product name
Anti-POLH
Provider product page
Atlas Antibodies - HPA006721
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
PPLTMLFLCATKFSASAPSSSTDITSFLSSDPSSL
PKVPVTSSEAKTQGSGPAVTATKKATTSLESFFQK
AAERQKVKEASLSSLTAPTQAPMSNSPSKPSLPFQ
TSQSTGTE
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -