Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations
- Immunohistochemistry [5]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA008786 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA008786, RRID:AB_10601720
- Product name
- Anti-TBX5
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
MSRMQSKEYPVVPRSTVRQKVASNHSPFSSESRAL
STSSNLGSQYQCENGVSGPSQDLLPPPNPYPLPQE
HSQIYHCTKRKEEECSTTDHPYKKPYMETSPSEED
SFYRSSYPQQQG- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Single-Cell Expression Profiling Reveals a Dynamic State of Cardiac Precursor Cells in the Early Mouse Embryo.
Directed cardiomyocyte differentiation from human pluripotent stem cells by modulating Wnt/β-catenin signaling under fully defined conditions
Kokkinopoulos I, Ishida H, Saba R, Ruchaya P, Cabrera C, Struebig M, Barnes M, Terry A, Kaneko M, Shintani Y, Coppen S, Shiratori H, Ameen T, Mein C, Hamada H, Suzuki K, Yashiro K
PloS one 2015;10(10):e0140831
PloS one 2015;10(10):e0140831
Directed cardiomyocyte differentiation from human pluripotent stem cells by modulating Wnt/β-catenin signaling under fully defined conditions
Lian X, Zhang J, Azarin S, Zhu K, Hazeltine L, Bao X, Hsiao C, Kamp T, Palecek S
Nature Protocols 2012 December;8(1):162-175
Nature Protocols 2012 December;8(1):162-175
No comments: Submit comment
Enhanced validation
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Enhanced method
- Orthogonal validation
- Main image
- Experimental details
- Immunohistochemistry analysis in human heart muscle and pancreas tissues using HPA008786 antibody. Corresponding TBX5 RNA-seq data are presented for the same tissues.
- Sample type
- HUMAN
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human heart muscle shows strong nuclear positivity in cardiomyocytes.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human lung shows moderate nuclear positivity in a subset of pneumocytes.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human placenta shows moderate nuclear positivity in Hofbauer cells, as well as weaker positivity in trophoblastic cells.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human pancreas shows no positivity in exocrine glandular cells as expected.
- Sample type
- HUMAN