Antibody data
- Antibody Data
- Antigen structure
- References [3]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00006910-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00006910-M01, RRID:AB_464100
- Product name
- TBX5 monoclonal antibody (M01), clone 1G10
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant TBX5.
- Antigen sequence
PSMPSYSSCTVTTVQPMDRLPYQHFSAHFTSGPLV
PRLAGMANHGSPQLGEGMFQHQTSVAHQPVVRQCG
PQTGLQSPGTLQPPEFLYSHGVPRTLSPHQYHSVH
GVGMVPEWSDNS- Isotype
- IgG
- Antibody clone number
- 1G10
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Holt-Oram syndrome with intermediate atrioventricular canal defect, and aortic coarctation: functional characterization of a de novo TBX5 mutation.
Directing cardiomyogenic differentiation of human pluripotent stem cells by plasmid-based transient overexpression of cardiac transcription factors.
Physical interaction between TBX5 and MEF2C is required for early heart development.
Baban A, Pitto L, Pulignani S, Cresci M, Mariani L, Gambacciani C, Digilio MC, Pongiglione G, Albanese S
American journal of medical genetics. Part A 2014 Jun;164A(6):1419-24
American journal of medical genetics. Part A 2014 Jun;164A(6):1419-24
Directing cardiomyogenic differentiation of human pluripotent stem cells by plasmid-based transient overexpression of cardiac transcription factors.
Hartung S, Schwanke K, Haase A, David R, Franz WM, Martin U, Zweigerdt R
Stem cells and development 2013 Apr 1;22(7):1112-25
Stem cells and development 2013 Apr 1;22(7):1112-25
Physical interaction between TBX5 and MEF2C is required for early heart development.
Ghosh TK, Song FF, Packham EA, Buxton S, Robinson TE, Ronksley J, Self T, Bonser AJ, Brook JD
Molecular and cellular biology 2009 Apr;29(8):2205-18
Molecular and cellular biology 2009 Apr;29(8):2205-18
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of TBX5 expression in transfected 293T cell line by TBX5 monoclonal antibody (M01), clone 1G10.Lane 1: TBX5 transfected lysate(57.7 KDa).Lane 2: Non-transfected lysate.