Antibody data
- Antibody Data
- Antigen structure
- References [3]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN182798 - Provider product page

- Provider
- antibodies-online
- Product name
- anti-T-Box 5 (TBX5) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-TBX5 antibody: synthetic peptide directed towards the N terminal of human TBX5
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Canine, Zebrafish
- Host
- Rabbit
- Antigen sequence
NSMHKYQPRLHIVKADENNGFGSKNTAFCTHVFPE
TAFIA VTSYQNHKIT- Epitope
- N-Term
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Phenanthrene exposure causes cardiac arrhythmia in embryonic zebrafish via perturbing calcium handling.
Induction of apoptosis and inhibition of cell growth by tbx5 knockdown contribute to dysmorphogenesis in Zebrafish embryos.
Identification of the TBX5 transactivating domain and the nuclear localization signal.
Zhang Y, Huang L, Zuo Z, Chen Y, Wang C
Aquatic toxicology (Amsterdam, Netherlands) 2013 Oct 15;142-143:26-32
Aquatic toxicology (Amsterdam, Netherlands) 2013 Oct 15;142-143:26-32
Induction of apoptosis and inhibition of cell growth by tbx5 knockdown contribute to dysmorphogenesis in Zebrafish embryos.
Lu J, Tsai T, Choo S, Yeh S, Tang R, Yang A, Lee H, Lu J
Journal of biomedical science 2011 Oct 8;18:73
Journal of biomedical science 2011 Oct 8;18:73
Identification of the TBX5 transactivating domain and the nuclear localization signal.
Zaragoza MV, Lewis LE, Sun G, Wang E, Li L, Said-Salman I, Feucht L, Huang T
Gene 2004 Apr 14;330:9-18
Gene 2004 Apr 14;330:9-18
No comments: Submit comment
No validations: Submit validation data