HPA008786

TBX5 antibody from Sigma-Aldrich
HOS
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA008786
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA008786, RRID:AB_10601720
Product name
Anti-TBX5 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA008786
Antibody type
Polyclonal
Antigen
T-box 5 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
MSRMQSKEYPVVPRSTVRQKVASNHSPFSSESRAL
STSSNLGSQYQCENGVSGPSQDLLPPPNPYPLPQE
HSQIYHCTKRKEEECSTTDHPYKKPYMETSPSEED
SFYRSSYPQQQG
Storage
-20C
Provider Type Product Number
- No reagents -