HPA020872

SFXN4 antibody from Atlas Antibodies
SLC56A4
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA020872
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA020872, RRID:AB_1856793
Product name
Anti-SFXN4
Provider product page
Atlas Antibodies - HPA020872
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
KYGLTGPWIKRLLPVIFLVQASGMNVYMSRSLESI
KGIAVMDKEGNVLGHSRIAGTKAVRET
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -