Antibody data

Product number
ABIN503482
Provider
antibodies-online
Product name
anti-Sideroflexin 4 (SFXN4) (C-Term) antibody
Provider product page
antibodies-online - ABIN503482
Antibody type
Polyclonal
Antigen
The immunogen for anti-SFXN4 antibody: synthetic peptide directed towards the C terminal of human SFXN4
Description
Affinity Purified
Reactivity
Human, Mouse
Host
Rabbit
Antigen sequence
SCTVLAMGLMVPFSFSIFPQIGQIQYCSLEEKIQS
PTEET EIFYHRGV
Epitope
C-Term
Vial size
50 μg
Concentration
1mg/mL
Storage
-20°C
Handling
Avoid repeated freeze-thaw cycles.
Provider Type Product Number
- No reagents -