Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [2]
- Immunocytochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00002954-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00002954-M01, RRID:AB_606341
- Product name
- GSTZ1 monoclonal antibody (M01), clone 1G12
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant GSTZ1.
- Antigen sequence
GIQPLQNLSVLKQVGEEMQLTWAQNAITCGFNALE
QILQSTAGIYCVGDEVTMADLCLVPQVANAERFKV
DLTPYPTISSINKRLLVLEAFQVSHPCRQPDTPTE
LRA- Isotype
- IgG
- Antibody clone number
- 1G12
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- GSTZ1 monoclonal antibody (M01), clone 1G12. Western Blot analysis of GSTZ1 expression in PC-12(Cat # L012V1 ).
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of GSTZ1 expression in transfected 293T cell line by GSTZ1 monoclonal antibody (M01), clone 1G12.Lane 1: GSTZ1 transfected lysate (Predicted MW: 24.1 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunofluorescence of monoclonal antibody to GSTZ1 on HepG2 cell. [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol