Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN311129 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Glutathione Transferase zeta 1 (Maleylacetoacetate Isomerase) (GSTZ1) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-GSTZ1 antibody: synthetic peptide directed towards the N terminal of human GSTZ1
- Description
- Protein A purified
- Reactivity
- Human, Mouse, Rat, Bovine
- Host
- Rabbit
- Antigen sequence
MQAGKPILYSYFRSSCSWRVRIALALKGIDYETVP
INLIK DGGQQFSKDF- Epitope
- N-Term
- Vial size
- 100 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Glutathione S-transferase polymorphisms and onset age in alpha-synuclein A53T mutant Parkinson's disease.
Golbe LI, Di Iorio G, Markopoulou K, Athanassiadou A, Papapetropoulos S, Watts RL, Vance JM, Bonifati V, Williams TA, Spychala JR, Stenroos ES, Johnson WG
American journal of medical genetics. Part B, Neuropsychiatric genetics : the official publication of the International Society of Psychiatric Genetics 2007 Mar 5;144B(2):254-8
American journal of medical genetics. Part B, Neuropsychiatric genetics : the official publication of the International Society of Psychiatric Genetics 2007 Mar 5;144B(2):254-8
No comments: Submit comment
No validations: Submit validation data