HPA004701

GSTZ1 antibody from Sigma-Aldrich
GSTZ1-1, MAAI, MAI
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA004701
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA004701, RRID:AB_1078990
Product name
Anti-GSTZ1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA004701
Antibody type
Polyclonal
Antigen
Maleylacetoacetate isomerase recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
NLSVLKQVGEEMQLTWAQNAITCGFNALEQILQST
AGIYCVGDEVTMADLCLVPQVANAERFKVDLTPYP
TISSINKRLLVLEAFQVSHPCRQPDTPTELRA
Storage
-20C
Provider Type Product Number
- No reagents -