HPA006725

RAD9A antibody from Sigma-Aldrich
RAD9
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA006725
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA006725, RRID:AB_1856041
Product name
Anti-RAD9A antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA006725
Antibody type
Polyclonal
Antigen
Cell cycle checkpoint control protein RAD9A recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
AIFTIKDSLLDGHFVLATLSDTDSHSQDLGSPERH
QPVPQLQAHSTPHPDDFANDDIDSYMIAMETTIGN
EGSRVLPSISLSPGPQPPKSPGPHSEEEDEAEPST
VPGTPPPKKFRSLFFGSILAPV
Storage
-20C
Provider Type Product Number
- No reagents -