HPA016040

VRK3 antibody from Sigma-Aldrich
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA016040
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA016040, RRID:AB_1858774
Product name
Anti-VRK3 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA016040
Antibody type
Polyclonal
Antigen
Serine/threonine-protein kinase VRK3 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
TTSLEALPTGTVLTDKSGRQWKLKSFQTRDNQGIL
YEAAPTSTLTCDSGPQKQKFSLKLDAKDGRLFNEQ
NFFQRAAKPLQVNKWKKLYSTPLLAIPTCMGFGVH
QDKYRFLVLPS
Storage
-20C
Provider Type Product Number
- No reagents -